Tnfrsf9 (Mouse) Recombinant Protein Ver mas grande

Tnfrsf9 (Mouse) Recombinant Protein

AB-P9217

Producto nuevo

Tnfrsf9 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 5 ug
Gene Name Tnfrsf9
Gene Alias 4-1BB|A930040I11Rik|AA408498|AI325004|CDw137|Cd137|ILA|Ly63
Gene Description tumor necrosis factor receptor superfamily, member 9
Storage Conditions Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLLEHHHHHH
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol.
Gene ID 21942

Más información

Mouse Tnfrsf9 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.

Consulta sobre un producto

Tnfrsf9 (Mouse) Recombinant Protein

Tnfrsf9 (Mouse) Recombinant Protein