View larger
Mouse Tnfrsf9 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
AB-P9217
New product
Tnfrsf9 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 5 ug |
| Gene Name | Tnfrsf9 |
| Gene Alias | 4-1BB|A930040I11Rik|AA408498|AI325004|CDw137|Cd137|ILA|Ly63 |
| Gene Description | tumor necrosis factor receptor superfamily, member 9 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | Solution (0.5 mg/mL) containing 1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 21942 |
More info
Mouse Tnfrsf9 partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.