Tff3 (Rat) Recombinant Protein
  • Tff3 (Rat) Recombinant Protein

Tff3 (Rat) Recombinant Protein

Ref: AB-P9200
Tff3 (Rat) Recombinant Protein

Información del producto

Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Tff3
Gene Alias ITF|TREFOIL
Gene Description trefoil factor 3, intestinal
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Specificity TFF3 Rat
Application Key SDS-PAGE
Immunogen Prot. Seq MQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFDYKDDDDK
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe
Gene ID 25563

Enviar un mensaje


Tff3 (Rat) Recombinant Protein

Tff3 (Rat) Recombinant Protein