View larger
Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in <i>Escherichia coli</i>.
AB-P9200
New product
Tff3 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Tff3 |
| Gene Alias | ITF|TREFOIL |
| Gene Description | trefoil factor 3, intestinal |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Specificity | TFF3 Rat |
| Immunogen Prot. Seq | MQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFDYKDDDDK |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe |
| Gene ID | 25563 |
More info
Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in Escherichia coli.