TFF1 (Human) Recombinant Protein
  • TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein

Ref: AB-P9195
TFF1 (Human) Recombinant Protein

Información del producto

Human TFF1 partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TFF1
Gene Alias BCEI|D21S21|HP1.A|HPS2|pNR-2|pS2
Gene Description trefoil factor 1
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Specificity TFF1 Human, His
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe
Gene ID 7031

Enviar un mensaje


TFF1 (Human) Recombinant Protein

TFF1 (Human) Recombinant Protein