View larger
Human TFF1 partial recombinant protein with His tag expressed in <i>Escherichia coli</i>.
AB-P9195
New product
TFF1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | TFF1 |
| Gene Alias | BCEI|D21S21|HP1.A|HPS2|pNR-2|pS2 |
| Gene Description | trefoil factor 1 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Specificity | TFF1 Human, His |
| Immunogen Prot. Seq | MKHHHHHHASEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe |
| Gene ID | 7031 |
More info
Human TFF1 partial recombinant protein with His tag expressed in Escherichia coli.