Ver mas grande
Retn (Mouse) Recombinant Protein
AB-P9161
Producto nuevo
Retn (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | Retn |
| Gene Alias | ADSF|Fizz3|Rstn|Xcp4 |
| Gene Description | resistin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MKKLLFAIPLVVPFYSHSTMASMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASLEDYKDDDDK |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer, pH4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
| Gene ID | 57264 |
Más información
Mouse Retn recombinant protein with flag tag in C-terminus expressed in Escherichia coli.