View larger
Mouse Retn recombinant protein with flag tag in C-terminus expressed in <i>Escherichia coli</i>.
AB-P9161
New product
Retn (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | Retn |
| Gene Alias | ADSF|Fizz3|Rstn|Xcp4 |
| Gene Description | resistin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MKKLLFAIPLVVPFYSHSTMASMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNCWTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREEKVCHCQCARIDWTAARCCKLQVASLEDYKDDDDK |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer, pH4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
| Gene ID | 57264 |
More info
Mouse Retn recombinant protein with flag tag in C-terminus expressed in Escherichia coli.