Ver mas grande
RETN (Human) Recombinant Protein
AB-P9159
Producto nuevo
RETN (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | RETN |
| Gene Alias | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 |
| Gene Description | resistin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 0.1% TFA. Add 0.2 ml of ddH<sub>2</sub>O and let the lyophilized pellet dissolve completely. |
| Gene ID | 56729 |
Más información
Human RETN recombinant protein expressed in Escherichia coli.