View larger
Human RETN recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9159
New product
RETN (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | RETN |
| Gene Alias | ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1 |
| Gene Description | resistin |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 0.1% TFA. Add 0.2 ml of ddH<sub>2</sub>O and let the lyophilized pellet dissolve completely. |
| Gene ID | 56729 |
More info
Human RETN recombinant protein expressed in Escherichia coli.