RETN (Human) Recombinant Protein
  • RETN (Human) Recombinant Protein

RETN (Human) Recombinant Protein

Ref: AB-P9157
RETN (Human) Recombinant Protein

Información del producto

Human RETN partial recombinant protein with His tag in C-terminus expressed in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name RETN
Gene Alias ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description resistin
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPHHHHHH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 20 mM Sodium citrate, pH 3.0, 20% glycerol.
Gene ID 56729

Enviar un mensaje


RETN (Human) Recombinant Protein

RETN (Human) Recombinant Protein