Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
RETN (Human) Recombinant Protein
Abnova
RETN (Human) Recombinant Protein
Ref: AB-P9157
RETN (Human) Recombinant Protein
Contacte-nos
Información del producto
Human RETN partial recombinant protein with His tag in C-terminus expressed in HEK293 cells.
Información adicional
Size
2 x 10 ug
Gene Name
RETN
Gene Alias
ADSF|FIZZ3|MGC126603|MGC126609|RETN1|RSTN|XCP1
Gene Description
resistin
Storage Conditions
Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQPHHHHHH
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution (1 mg/mL) containing 20 mM Sodium citrate, pH 3.0, 20% glycerol.
Gene ID
56729
Enviar uma mensagem
RETN (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*