Ver mas grande
RETNLB (Human) Recombinant Protein
AB-P9151
Producto nuevo
RETNLB (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | RETNLB |
| Gene Alias | FIZZ1|FIZZ2|HXCP2|RELM-beta|RELMb|RELMbeta|XCP2 |
| Gene Description | resistin like beta |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in 0.1% TFA to 100 ug/mL. |
| Gene ID | 84666 |
| Iso type | Escherichia Coli. |
Más información
Human RETNLB recombinant protein expressed in Escherichia coli.