RETNLB (Human) Recombinant Protein
  • RETNLB (Human) Recombinant Protein

RETNLB (Human) Recombinant Protein

Ref: AB-P9151
RETNLB (Human) Recombinant Protein

Información del producto

Human RETNLB recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name RETNLB
Gene Alias FIZZ1|FIZZ2|HXCP2|RELM-beta|RELMb|RELMbeta|XCP2
Gene Description resistin like beta
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in 0.1% TFA to 100 ug/mL.
Gene ID 84666
Iso type Escherichia Coli.

Enviar uma mensagem


RETNLB (Human) Recombinant Protein

RETNLB (Human) Recombinant Protein