Ver mas grande
RETNLB (Human) Recombinant Protein
AB-P9150
Producto nuevo
RETNLB (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | RETNLB |
| Gene Alias | FIZZ1|FIZZ2|HXCP2|RELM-beta|RELMb|RELMbeta|XCP2 |
| Gene Description | resistin like beta |
| Storage Conditions | Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTKLRSHHHHHH |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate bufer, pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 10 ug/mL. In higher concentrations the solubility of this antigen is limited. |
| Gene ID | 84666 |
| Iso type | Escherichia Coli. |
Más información
Human RETNLB recombinant protein with His tag expressed in Escherichia coli.