RETNLB (Human) Recombinant Protein
  • RETNLB (Human) Recombinant Protein

RETNLB (Human) Recombinant Protein

Ref: AB-P9150
RETNLB (Human) Recombinant Protein

Información del producto

Human RETNLB recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name RETNLB
Gene Alias FIZZ1|FIZZ2|HXCP2|RELM-beta|RELMb|RELMbeta|XCP2
Gene Description resistin like beta
Storage Conditions Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTKLRSHHHHHH
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate bufer, pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 10 ug/mL. In higher concentrations the solubility of this antigen is limited.
Gene ID 84666
Iso type Escherichia Coli.

Enviar uma mensagem


RETNLB (Human) Recombinant Protein

RETNLB (Human) Recombinant Protein