Retnla (Mouse) Recombinant Protein Ver mas grande

Retnla (Mouse) Recombinant Protein

AB-P9148

Producto nuevo

Retnla (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 25 ug
Gene Name Retnla
Gene Alias 1810019L16Rik|Fizz-1|Fizz1|HIMF|RELM-alpha|RELMa|RELMalpha|Xcp2
Gene Description resistin like alpha
Storage Conditions Lyophilized protein should be stored at -20ºC. Protein aliquots at 4ºC for 2 weeks. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 10 mM Sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.1 mg/mL.
Gene ID 57262
Iso type Escherichia Coli.

Más información

Mouse Retnla recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Retnla (Mouse) Recombinant Protein

Retnla (Mouse) Recombinant Protein