Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
Retnla (Mouse) Recombinant Protein
Abnova
Retnla (Mouse) Recombinant Protein
Ref: AB-P9148
Retnla (Mouse) Recombinant Protein
Contacte-nos
Información del producto
Mouse Retnla recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
Retnla
Gene Alias
1810019L16Rik|Fizz-1|Fizz1|HIMF|RELM-alpha|RELMa|RELMalpha|Xcp2
Gene Description
resistin like alpha
Storage Conditions
Lyophilized protein should be stored at -20C. Protein aliquots at 4C for 2 weeks.
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
Form
Lyophilized
Antigen species Target species
Mouse
Storage Buffer
Protein (0.5 mg/mL) was lyophilized from a solution containing 10 mM Sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH
2
O to 0.1 mg/mL.
Gene ID
57262
Iso type
Escherichia Coli.
Enviar uma mensagem
Retnla (Mouse) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*