Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
DHH (Human) Recombinant Protein
Abnova
DHH (Human) Recombinant Protein
Ref: AB-P9138
DHH (Human) Recombinant Protein
Contáctenos
Información del producto
Human DHH partial recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
DHH
Gene Alias
HHG-3|MGC35145
Gene Description
desert hedgehog homolog (Drosophila)
Storage Conditions
Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG
Form
Liquid
Antigen species Target species
Human
Storage Buffer
Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 7.5, 10% glycerol, 0.15 mM NaCl, 1 mM DTT.
Gene ID
50846
Iso type
Escherichia Coli.
Enviar un mensaje
DHH (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*