Ver mas grande
DHH (Human) Recombinant Protein
AB-P9138
Producto nuevo
DHH (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | DHH |
| Gene Alias | HHG-3|MGC35145 |
| Gene Description | desert hedgehog homolog (Drosophila) |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 7.5, 10% glycerol, 0.15 mM NaCl, 1 mM DTT. |
| Gene ID | 50846 |
| Iso type | Escherichia Coli. |
Más información
Human DHH partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.