AB-P9138
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 25 ug |
Gene Name | DHH |
Gene Alias | HHG-3|MGC35145 |
Gene Description | desert hedgehog homolog (Drosophila) |
Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMIIGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
Form | Liquid |
Antigen species Target species | Human |
Storage Buffer | Solution (0.25 mg/mL) containing 20 mM Tris-HCl, pH 7.5, 10% glycerol, 0.15 mM NaCl, 1 mM DTT. |
Gene ID | 50846 |
Iso type | Escherichia Coli. |