Ver mas grande
CD79B (Human) Recombinant Protein
AB-P9105
Producto nuevo
CD79B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CD79B |
| Gene Alias | B29|IGB |
| Gene Description | CD79b molecule, immunoglobulin-associated beta |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 2M UREA and 10% glycerol. |
| Gene ID | 974 |
Más información
Human CD79B (P40259, 29 a.a. - 159 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.