CD79B (Human) Recombinant Protein
  • CD79B (Human) Recombinant Protein

CD79B (Human) Recombinant Protein

Ref: AB-P9105
CD79B (Human) Recombinant Protein

Información del producto

Human CD79B (P40259, 29 a.a. - 159 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CD79B
Gene Alias B29|IGB
Gene Description CD79b molecule, immunoglobulin-associated beta
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH 8.0), 2M UREA and 10% glycerol.
Gene ID 974

Enviar uma mensagem


CD79B (Human) Recombinant Protein

CD79B (Human) Recombinant Protein