Ver mas grande
CD37 (Human) Recombinant Protein
AB-P9082
Producto nuevo
CD37 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CD37 |
| Gene Alias | GP52-40|MGC120234|TSPAN26 |
| Gene Description | CD37 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | PBS (pH7.4) and 10% glycerol. |
| Gene ID | 951 |
Más información
Human CD37 (P11049, 112 a.a. - 241 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.