Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD37 (Human) Recombinant Protein
Abnova
CD37 (Human) Recombinant Protein
Ref: AB-P9082
CD37 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CD37 (P11049, 112 a.a. - 241 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
CD37
Gene Alias
GP52-40|MGC120234|TSPAN26
Gene Description
CD37 molecule
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
PBS (pH7.4) and 10% glycerol.
Gene ID
951
Enviar un mensaje
CD37 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*