View larger
Human CD37 (P11049, 112 a.a. - 241 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherich
AB-P9082
New product
CD37 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CD37 |
| Gene Alias | GP52-40|MGC120234|TSPAN26 |
| Gene Description | CD37 molecule |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSQRAQLERSLRDVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHNN. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | PBS (pH7.4) and 10% glycerol. |
| Gene ID | 951 |
More info
Human CD37 (P11049, 112 a.a. - 241 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.