Ver mas grande
Scgb1a1 (Mouse) Recombinant Protein
AB-P9078
Producto nuevo
Scgb1a1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Scgb1a1 |
| Gene Alias | CC10|CC16|CCSP|PCB-BP|UG|UGB|Utg |
| Gene Description | secretoglobin, family 1A, member 1 (uteroglobin) |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF. |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
| Gene ID | 22287 |
Más información
Mouse Scgb1a1 (Q06318) recombinant protein expressed in Escherichia coli.