Scgb1a1 (Mouse) Recombinant Protein
  • Scgb1a1 (Mouse) Recombinant Protein

Scgb1a1 (Mouse) Recombinant Protein

Ref: AB-P9078
Scgb1a1 (Mouse) Recombinant Protein

Información del producto

Mouse Scgb1a1 (Q06318) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Scgb1a1
Gene Alias CC10|CC16|CCSP|PCB-BP|UG|UGB|Utg
Gene Description secretoglobin, family 1A, member 1 (uteroglobin)
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 22287

Enviar uma mensagem


Scgb1a1 (Mouse) Recombinant Protein

Scgb1a1 (Mouse) Recombinant Protein