Cd40lg (Mouse) Recombinant Protein Ver mas grande

Cd40lg (Mouse) Recombinant Protein

AB-P9075

Producto nuevo

Cd40lg (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 5 ug
Gene Name Cd40lg
Gene Alias CD154|Cd40l|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|TRAP|Tnfsf5|gp39
Gene Description CD40 ligand
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLHHHHHH.
Form Liquid
Antigen species Target species Mouse
Storage Buffer PBS (pH7.4) and 10% glycerol.
Gene ID 21947

Más información

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.

Consulta sobre un producto

Cd40lg (Mouse) Recombinant Protein

Cd40lg (Mouse) Recombinant Protein