Cd40lg (Mouse) Recombinant Protein View larger

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculov

AB-P9075

New product

Cd40lg (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 5 ug
Gene Name Cd40lg
Gene Alias CD154|Cd40l|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|TRAP|Tnfsf5|gp39
Gene Description CD40 ligand
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLHHHHHH.
Form Liquid
Antigen species Target species Mouse
Storage Buffer PBS (pH7.4) and 10% glycerol.
Gene ID 21947

More info

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.

Enviar uma mensagem

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculov

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculov