Cd40lg (Mouse) Recombinant Protein
  • Cd40lg (Mouse) Recombinant Protein

Cd40lg (Mouse) Recombinant Protein

Ref: AB-P9075
Cd40lg (Mouse) Recombinant Protein

Información del producto

Mouse Cd40lg (P27548, 112 a.a. - 260 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 5 ug
Gene Name Cd40lg
Gene Alias CD154|Cd40l|HIGM1|IGM|IMD3|Ly-62|Ly62|T-BAM|TRAP|Tnfsf5|gp39
Gene Description CD40 ligand
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MQRGDEDPQIAAHVVSEANSNAASVLQWAKKGYYTMKSNLVMLENGKQLTVKREGLYYVYTQVTFCSNREPSSQRPFIVGLWLKPSSGSERILLKAANTHSSSQLCEQQSVHLGGVFELQAGASVFVNVTEASQVIHRVGFSSFGLLKLHHHHHH.
Form Liquid
Antigen species Target species Mouse
Storage Buffer PBS (pH7.4) and 10% glycerol.
Gene ID 21947

Enviar uma mensagem


Cd40lg (Mouse) Recombinant Protein

Cd40lg (Mouse) Recombinant Protein