PIP (Human) Recombinant Protein
  • PIP (Human) Recombinant Protein

PIP (Human) Recombinant Protein

Ref: AB-P9064
PIP (Human) Recombinant Protein

Información del producto

Human PIP (P12273, 29 a.a. - 146 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name PIP
Gene Alias GCDFP-15|GCDFP15|GPIP4
Gene Description prolactin-induced protein
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer, (pH 8.0), 10% glycerol and 0.4M Urea.
Gene ID 5304

Enviar un mensaje


PIP (Human) Recombinant Protein

PIP (Human) Recombinant Protein