Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
PIP (Human) Recombinant Protein
Abnova
PIP (Human) Recombinant Protein
Ref: AB-P9064
PIP (Human) Recombinant Protein
Contacte-nos
Información del producto
Human PIP (P12273, 29 a.a. - 146 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
PIP
Gene Alias
GCDFP-15|GCDFP15|GPIP4
Gene Description
prolactin-induced protein
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE.
Form
Liquid
Antigen species Target species
Human
Storage Buffer
20mM Tris-HCl buffer, (pH 8.0), 10% glycerol and 0.4M Urea.
Gene ID
5304
Enviar uma mensagem
PIP (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*