Ver mas grande
PIP (Human) Recombinant Protein
AB-P9063
Producto nuevo
PIP (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | PIP |
| Gene Alias | GCDFP-15|GCDFP15|GPIP4 |
| Gene Description | prolactin-induced protein |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M phosphate buffer and 0.075M NaCl pH 8.0. |
| Gene ID | 5304 |
Más información
Human PIP (P12273) isolated protein from Human Seminal Plasma.