View larger
Human PIP (P12273) isolated protein from Human Seminal Plasma.
AB-P9063
New product
PIP (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | PIP |
| Gene Alias | GCDFP-15|GCDFP15|GPIP4 |
| Gene Description | prolactin-induced protein |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.05M phosphate buffer and 0.075M NaCl pH 8.0. |
| Gene ID | 5304 |
More info
Human PIP (P12273) isolated protein from Human Seminal Plasma.