PGF (Human) Recombinant Protein
  • PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein

Ref: AB-P9043
PGF (Human) Recombinant Protein

Información del producto

Human PGF (P49763) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.1% Trifluoroacetic Acid (TFA).
Gene ID 5228

Enviar un mensaje


PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein