Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
PGF (Human) Recombinant Protein
Abnova
PGF (Human) Recombinant Protein
Ref: AB-P9043
PGF (Human) Recombinant Protein
Contacte-nos
Información del producto
Human PGF (P49763) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
25 ug
Gene Name
PGF
Gene Alias
D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description
placental growth factor
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR.
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from 0.1% Trifluoroacetic Acid (TFA).
Gene ID
5228
Enviar uma mensagem
PGF (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*