PGF (Human) Recombinant Protein Ver mas grande

PGF (Human) Recombinant Protein

AB-P9042

Producto nuevo

PGF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.4 and 0.02 % Tween-20.
Gene ID 5228

Más información

Human PGF (P49763) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein