PGF (Human) Recombinant Protein
  • PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein

Ref: AB-P9042
PGF (Human) Recombinant Protein

Información del producto

Human PGF (P49763) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.4 and 0.02 % Tween-20.
Gene ID 5228

Enviar uma mensagem


PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein