Ver mas grande
PGF (Human) Recombinant Protein
AB-P9035
Producto nuevo
PGF (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | PGF |
| Gene Alias | D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760 |
| Gene Description | placental growth factor |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from Acetonitrile and TFA. |
| Gene ID | 5228 |
Más información
Human PGF (P49763, 21 a.a. - 221 a.a.) partial-length recombinant protein expressed in Escherichia coli.