PGF (Human) Recombinant Protein
  • PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein

Ref: AB-P9035
PGF (Human) Recombinant Protein

Información del producto

Human PGF (P49763, 21 a.a. - 221 a.a.) partial-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from Acetonitrile and TFA.
Gene ID 5228

Enviar uma mensagem


PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein