Ver mas grande
POSTN (Human) Recombinant Protein
AB-P9025
Producto nuevo
POSTN (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | POSTN |
| Gene Alias | MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin |
| Gene Description | periostin, osteoblast specific factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | NNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from phosphate buffered saline and 5% trehalose. |
| Gene ID | 10631 |
Más información
Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.