Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
POSTN (Human) Recombinant Protein
Abnova
POSTN (Human) Recombinant Protein
Ref: AB-P9025
POSTN (Human) Recombinant Protein
Contacte-nos
Información del producto
Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
Información adicional
Size
2 x 10 ug
Gene Name
POSTN
Gene Alias
MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin
Gene Description
periostin, osteoblast specific factor
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
SDS-PAGE
Immunogen Prot. Seq
NNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTN
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from phosphate buffered saline and 5% trehalose.
Gene ID
10631
Enviar uma mensagem
POSTN (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*