POSTN (Human) Recombinant Protein View larger

Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.

AB-P9025

New product

POSTN (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name POSTN
Gene Alias MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin
Gene Description periostin, osteoblast specific factor
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from phosphate buffered saline and 5% trehalose.
Gene ID 10631

More info

Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.

Enviar uma mensagem

Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.

Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.