POSTN (Human) Recombinant Protein
  • POSTN (Human) Recombinant Protein

POSTN (Human) Recombinant Protein

Ref: AB-P9025
POSTN (Human) Recombinant Protein

Información del producto

Human POSTN (Q15063, 22 a.a. - 836 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in HEK293 cell.
Información adicional
Size 2 x 10 ug
Gene Name POSTN
Gene Alias MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin
Gene Description periostin, osteoblast specific factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq NNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTN
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from phosphate buffered saline and 5% trehalose.
Gene ID 10631

Enviar uma mensagem


POSTN (Human) Recombinant Protein

POSTN (Human) Recombinant Protein