PDGFRB (Human) Recombinant Protein
  • PDGFRB (Human) Recombinant Protein

PDGFRB (Human) Recombinant Protein

Ref: AB-P9018
PDGFRB (Human) Recombinant Protein

Información del producto

Human PDGFRB (P09619, 33 a.a. - 532 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name PDGFRB
Gene Alias CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description platelet-derived growth factor receptor, beta polypeptide
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSG
Form Liquid
Antigen species Target species Human
Storage Buffer Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 5159

Enviar un mensaje


PDGFRB (Human) Recombinant Protein

PDGFRB (Human) Recombinant Protein