Ver mas grande
PDGFRB (Human) Recombinant Protein
AB-P9018
Producto nuevo
PDGFRB (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | PDGFRB |
| Gene Alias | CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1 |
| Gene Description | platelet-derived growth factor receptor, beta polypeptide |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSG |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 5159 |
Más información
Human PDGFRB (P09619, 33 a.a. - 532 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.