View larger
Human PDGFRB (P09619, 33 a.a. - 532 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculovi
AB-P9018
New product
PDGFRB (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | PDGFRB |
| Gene Alias | CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1 |
| Gene Description | platelet-derived growth factor receptor, beta polypeptide |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | LVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSG |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 5159 |
More info
Human PDGFRB (P09619, 33 a.a. - 532 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.