Ver mas grande
PDGFC (Human) Recombinant Protein
AB-P9015
Producto nuevo
PDGFC (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | PDGFC |
| Gene Alias | FALLOTEIN|SCDGF |
| Gene Description | platelet derived growth factor C |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MHHHHHHVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from Acetonitrile and TFA. |
| Gene ID | 56034 |
Más información
Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.