PDGFC (Human) Recombinant Protein View larger

Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escheric

AB-P9015

New product

PDGFC (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name PDGFC
Gene Alias FALLOTEIN|SCDGF
Gene Description platelet derived growth factor C
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq MHHHHHHVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from Acetonitrile and TFA.
Gene ID 56034

More info

Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.

Enviar uma mensagem

Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escheric

Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escheric