Pdgfa (Rat) Recombinant Protein Ver mas grande

Pdgfa (Rat) Recombinant Protein

AB-P9007

Producto nuevo

Pdgfa (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name Pdgfa
Gene Alias PDGFACP
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH7.0.
Gene ID 25266

Más información

Rat Pdgfa (P28576) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Pdgfa (Rat) Recombinant Protein

Pdgfa (Rat) Recombinant Protein