Pdgfa (Rat) Recombinant Protein
  • Pdgfa (Rat) Recombinant Protein

Pdgfa (Rat) Recombinant Protein

Ref: AB-P9007
Pdgfa (Rat) Recombinant Protein

Información del producto

Rat Pdgfa (P28576) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Pdgfa
Gene Alias PDGFACP
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH7.0.
Gene ID 25266

Enviar un mensaje


Pdgfa (Rat) Recombinant Protein

Pdgfa (Rat) Recombinant Protein