View larger
Rat Pdgfa (P28576) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P9007
New product
Pdgfa (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Pdgfa |
| Gene Alias | PDGFACP |
| Gene Description | platelet-derived growth factor alpha polypeptide |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETDVR. |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from PBS, pH7.0. |
| Gene ID | 25266 |
More info
Rat Pdgfa (P28576) recombinant protein expressed in Escherichia coli.