TNFRSF11B (Human) Recombinant Protein Ver mas grande

TNFRSF11B (Human) Recombinant Protein

AB-P8989

Producto nuevo

TNFRSF11B (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 4982

Más información

Human TNFRSF11B (O00300) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein