TNFRSF11B (Human) Recombinant Protein
  • TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein

Ref: AB-P8989
TNFRSF11B (Human) Recombinant Protein

Información del producto

Human TNFRSF11B (O00300) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 4982

Enviar un mensaje


TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein