Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
TNFRSF11B (Human) Recombinant Protein
Abnova
TNFRSF11B (Human) Recombinant Protein
Ref: AB-P8989
TNFRSF11B (Human) Recombinant Protein
Contacte-nos
Información del producto
Human TNFRSF11B (O00300) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
50 ug
Gene Name
TNFRSF11B
Gene Alias
MGC29565|OCIF|OPG|TR1
Gene Description
tumor necrosis factor receptor superfamily, member 11b
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK.
Form
Lyophilized
Antigen species Target species
Human
Storage Buffer
Lyophilized from PBS, pH 7.4.
Gene ID
4982
Enviar uma mensagem
TNFRSF11B (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*