View larger
Human TNFRSF11B (O00300) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8989
New product
TNFRSF11B (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | TNFRSF11B |
| Gene Alias | MGC29565|OCIF|OPG|TR1 |
| Gene Description | tumor necrosis factor receptor superfamily, member 11b |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | METFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQK. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
| Gene ID | 4982 |
More info
Human TNFRSF11B (O00300) recombinant protein expressed in Escherichia coli.