ITLN1 (Human) Recombinant Protein Ver mas grande

ITLN1 (Human) Recombinant Protein

AB-P8985

Producto nuevo

ITLN1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name ITLN1
Gene Alias FLJ20022|HL-1|HL1|INTL|ITLN|LFR|hIntL|omentin
Gene Description intelectin 1 (galactofuranose binding)
Storage Conditions Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles.
Immunogen Prot. Seq MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFNNERAANALCAGMRVTGCNTEHHC
Form Lyophilized
Antigen species Target species Human
Storage Buffer 10mM NaP, pH-7.5 and 5:1 mannitol to protein.
Gene ID 55600

Más información

Human ITLN1 (Q8WWA0) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

ITLN1 (Human) Recombinant Protein

ITLN1 (Human) Recombinant Protein