ITLN1 (Human) Recombinant Protein
  • ITLN1 (Human) Recombinant Protein

ITLN1 (Human) Recombinant Protein

Ref: AB-P8985
ITLN1 (Human) Recombinant Protein

Información del producto

Human ITLN1 (Q8WWA0) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name ITLN1
Gene Alias FLJ20022|HL-1|HL1|INTL|ITLN|LFR|hIntL|omentin
Gene Description intelectin 1 (galactofuranose binding)
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MNQLSFLLFLIATTRGWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFNNERAANALCAGMRVTGCNTEHHC
Form Lyophilized
Antigen species Target species Human
Storage Buffer 10mM NaP, pH-7.5 and 5:1 mannitol to protein.
Gene ID 55600

Enviar uma mensagem


ITLN1 (Human) Recombinant Protein

ITLN1 (Human) Recombinant Protein